Home > Buy Now > Other Health Care Products > CJC-1295 / CJC1295 (Sale@ghormone.Com)
 
left_top_06.jpg


Ghormone Biotech Co.,Ltd.
 
icon HGH/Jintropin
icon HCG(Human Chorionic Gonadotropin)
icon IGF-1 LR3
icon GHRP-2/GHRP-6
icon CJC1295/Cjc 1295 Dac
icon HGH Fragment/AOD9604
icon TB-500
icon MT-II/Melanotan II
icon Ser/Hex/Ipamorelin
icon EPO 3000iu
icon ACE031
icon GDF-8
icon Selank
icon FST344
icon Peg Mgf/Mgf
icon Gonadorelin
icon PT-141

line

icon Company Profile
icon Selling Leads
icon Index

line



visitors: 72751
 
Contact us
Ghormone Biotech Co.,Ltd.
[China]
Address:
No. 608 Huaming Building, Yannan Road, Futian Shenzhen Guangdong China
Phone:
+86-1-3729827702
Contact name:
Katrina Lai , Marketing Manager



Ghormone Biotech Co.,Ltd. Ghormone Biotech Co.,Ltd.
 
CJC1295/Cjc 1295 Dac

CJC-1295 / CJC1295 (Sale@ghormone.Com)

Facebook   Twitter   Delicious   Google   My EC21   Email this page   Report Item Inquire now
CJC-1295 / CJC1295           (Sale@ghormone.Com)

Click to enlarge image

 Origin

China

 Brand Name

CJC-1295

 Purity

>98%

 Email

katrina@ghormone.com

 Skype

somakatrina

 WhatsApp

+8613729827702


FSkype me :somakatrina
WhatsApp:+8613729827702

 
Sequence H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
CAS No. 863288-34-0
One Letter Sequence Y(D-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2
Specification 2mg
 Appearance White powder
Form & Formulations Steriless Filtered white lyophilized (Freeze-Dried)
Purity >98% by RP-HPLC
Water Content ≤ 7.0% by Karl Fischer
Acetate Content ≤ 10.0% by RP-HPLC
Bacterial Endotoxins  ≤ 5EU/mg
Suitability Suitable for cell culture and animal experiment, Not for human use! 
Storage Lyophilized powder although stable at room temperature for 2 months, it should be stored at -20°C(stable in 2 years) 

Payment: Western Union, TT, BitCoin, MoneyGram are available.
 

Related Keywords: HGH , IGF-1 LR3 , cjc-1295

  Price

USD   .1 / 5

  Price Condition

FOB   Shanghai or Shenzhen

  Packaging

10 vials/kit

  Delivery lead time

1-3 days

  Minimum order

1 Kit

  Supply ability

40000 vails/month


Inquire now


   
 
 

Chat Online with Ghormone Biotech Co.,Ltd. .
Click the "S Chat" Icon on the right hand to contact Ghormone Biotech Co.,Ltd. .
Note: Please ensure you have installed Skype program in your computer.
           If you don't have yet, click here to download Skype.

Close Window